PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn094971
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 880aa    MW: 97915 Da    PI: 6.8817
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn094971genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.18.4e-29564615152
      RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 aek+i+l++l +yF++++kdAAk+Lgvc+T+LKriCRq+G+kRWP+Rkik++
  Achn094971 564 AEKTITLQTLGQYFAGSLKDAAKSLGVCPTTLKRICRQHGVKRWPSRKIKKV 615
                 589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.427554635IPR003035RWP-RK domain
PfamPF020424.6E-25567615IPR003035RWP-RK domain
SuperFamilySSF542778.5E-23775868No hitNo description
Gene3DG3DSA:3.10.20.2406.6E-22780861No hitNo description
SMARTSM006661.3E-22781864IPR000270PB1 domain
PROSITE profilePS5174524.037781864IPR000270PB1 domain
CDDcd064072.06E-37782863No hitNo description
PfamPF005649.0E-17784863IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 880 aa     Download sequence    Send to blast
MDSRDFSPNT MLADSVNMDL DYIDELLLEG CWLEMETTQG SEFLHCSPST LSPLFDSSFI  60
WPSFEATHGE SSVNPSQNDT QQERQRSSFP ENLSTSETQM QNPTKILSPS HNLLDLSGCS  120
DLSRRFWIGP KANPGPRSSV MDRLIRALEY IKDSKRNKDA LIQLWVPVNS GGRRFLTTSD  180
QPFSLDLNSP SLASYRDISV KYQFPTEENS KEIAGLPGRV FKGKVPEWSP DVRFFRSDEF  240
ARVDHAQQCG ISGTLALPVF EQGSQNCLGV IEVVLTTQKA NCRPEFESVC KALEAVDLRS  300
SEVSIGQNVK ACNGSYQAAL TEILEVLRSA CGTHQLPLAQ TWVPCIQQGK EGSRHSDENH  360
TRCVSTVDSA CYVADLRMLD FQEACSEHHL LKGQGVAGQA FMTNQPCFSY DVTSFPKTEY  420
PLSHHAKIFG LRAAVAIRLR STYTGTADFV LEFFLPIDCT DFEEQRKMLA SLSIIIQRVC  480
HSLRIITDKE LEEENKAIRE SGNAVPLFQE MPIEASTKKS LDFKQSQHDP GLRTSVSFSG  540
DHSSFGEASF LNAEKAGERR RAKAEKTITL QTLGQYFAGS LKDAAKSLGV CPTTLKRICR  600
QHGVKRWPSR KIKKVGHSLQ RLQTVMDSVQ GGSGAFQIES FYSNFPDLAS PNMSTSKPSD  660
RSKLSNVQPR SGTFSRAVVS KSPSSSCSQS SSSSQYCSSK TQPNASTLNT VCGEDQTAKE  720
NLGNIVLKRA RSEVEFHVSS DEVQKNLPRS QSHKSLIEHQ KSEKLPPVPR SGGGKSQGQD  780
ALLIKVTYGE EKIRLRMQNN WAYKNLFQEI VRRFAIDDMN GFHLKYLDDE YEWVLLTCDS  840
DLEECIDLCR LTQTHTIKLS LFQNPQQHSG SSFGSSSPS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010663969.10.0PREDICTED: protein NLP4-like
RefseqXP_010663968.10.0PREDICTED: protein NLP4-like
RefseqXP_010663967.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA5APM70.0A5APM7_VITVI; Putative uncharacterized protein
STRINGPGSC0003DMT4000256570.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein